![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
![]() | Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins) |
![]() | Protein Hypothetical protein YecD [102298] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102299] (1 PDB entry) |
![]() | Domain d1j2ra_: 1j2r A: [90788] structural genomics complexed with mpd |
PDB Entry: 1j2r (more details), 1.3 Å
SCOPe Domain Sequences for d1j2ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2ra_ c.33.1.3 (A:) Hypothetical protein YecD {Escherichia coli [TaxId: 562]} mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsa dyaealkqpvdapspakvlpenwwqhpaalgttdsdieiikrqwgafygtdlelqlrrrg idtivlcgistnigvestarnawelgfnlviaedacsaasaeqhnnsinhiypriarvrs veeilnal
Timeline for d1j2ra_: