Lineage for d1j2fb_ (1j2f B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049541Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2049542Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2049651Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
    weak sequence similarity to SMAD domain
  6. 2049652Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)
  7. 2049653Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)
  8. 2049663Domain d1j2fb_: 1j2f B: [90786]

Details for d1j2fb_

PDB Entry: 1j2f (more details), 2.3 Å

PDB Description: X-ray crystal structure of IRF-3 and its functional implications
PDB Compounds: (B:) Interferon regulatory factor 3

SCOPe Domain Sequences for d1j2fb_:

Sequence, based on SEQRES records: (download)

>d1j2fb_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

Sequence, based on observed residues (ATOM records): (download)

>d1j2fb_ b.26.1.3 (B:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevtlpgwpvtlpdpgms
ltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgev
pkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptc
lralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

SCOPe Domain Coordinates for d1j2fb_:

Click to download the PDB-style file with coordinates for d1j2fb_.
(The format of our PDB-style files is described here.)

Timeline for d1j2fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j2fa_