SCOPe 2.06: Domain d1j2fa_: 1j2f A:

Lineage for d1j2fa_ (1j2f A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
   weak sequence similarity to SMAD domain

6. Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)

8. Domain d1j2fa_: 1j2f A: [90785]

Details for d1j2fa_

PDB Entry: 1j2f, 2.3 Å

PDB Description: X-ray crystal structure of IRF-3 and its functional implications

PDB Compounds: (A:) Interferon regulatory factor 3

SCOPe Domain Sequences for d1j2fa_:

Sequence, based on SEQRES records:

>d1j2fa_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdpg
msltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdg
evpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvp
tclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

Sequence, based on observed residues (ATOM records):

>d1j2fa_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvglpgwpvtlpdpgmsltdrg
vmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdke
ggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclralv
emarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

Timeline for d1j2fa_:

• d1j2fa_ first appeared in SCOP 1.67
  
• d1j2fa_ appears in SCOPe 2.05
  
• d1j2fa_ appears in SCOPe 2.07
  
• d1j2fa_ appears in the current release, SCOPe 2.08