Lineage for d1j2fa_ (1j2f A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372958Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
    weak sequence similarity to SMAD domain
  6. 2372959Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)
  7. 2372960Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)
  8. 2372969Domain d1j2fa_: 1j2f A: [90785]

Details for d1j2fa_

PDB Entry: 1j2f (more details), 2.3 Å

PDB Description: X-ray crystal structure of IRF-3 and its functional implications
PDB Compounds: (A:) Interferon regulatory factor 3

SCOPe Domain Sequences for d1j2fa_:

Sequence, based on SEQRES records: (download)

>d1j2fa_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdpg
msltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdg
evpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvp
tclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

Sequence, based on observed residues (ATOM records): (download)

>d1j2fa_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
nplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvglpgwpvtlpdpgmsltdrg
vmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpdgevpkdke
ggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvvptclralv
emarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

SCOPe Domain Coordinates for d1j2fa_:

Click to download the PDB-style file with coordinates for d1j2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1j2fa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j2fb_