Class a: All alpha proteins [46456] (226 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins) |
Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (11 PDB entries) |
Domain d1j2ca_: 1j2c A: [90780] complexed with bla, fe |
PDB Entry: 1j2c (more details), 2.4 Å
SCOP Domain Sequences for d1j2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2ca_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus)} dsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeie rnkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthp ellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarm ntlemtpevkhrvteeaktafllnielfeelqallt
Timeline for d1j2ca_: