Lineage for d1j1yb_ (1j1y B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201078Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1201079Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1201307Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1201377Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 1201383Species Thermus thermophilus [TaxId:274] [102909] (1 PDB entry)
  8. 1201385Domain d1j1yb_: 1j1y B: [90777]
    complexed with cl, mg

Details for d1j1yb_

PDB Entry: 1j1y (more details), 1.7 Å

PDB Description: Crystal Structure of PaaI from Thermus thermophilus HB8
PDB Compounds: (B:) PaaI protein

SCOPe Domain Sequences for d1j1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1yb_ d.38.1.5 (B:) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1j1yb_:

Click to download the PDB-style file with coordinates for d1j1yb_.
(The format of our PDB-style files is described here.)

Timeline for d1j1yb_: