![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins) |
![]() | Protein Phenylacetic acid degradation protein PaaI [89903] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries) |
![]() | Domain d1j1yb_: 1j1y B: [90777] complexed with cl, mg |
PDB Entry: 1j1y (more details), 1.7 Å
SCOP Domain Sequences for d1j1yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1yb_ d.38.1.5 (B:) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
Timeline for d1j1yb_: