SCOP 1.73: Domain d1j1yb_: 1j1y B:

Lineage for d1j1yb_ (1j1y B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)

6. Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries)

8. Domain d1j1yb_: 1j1y B: [90777]
   complexed with cl, mg

Details for d1j1yb_

PDB Entry: 1j1y, 1.7 Å

PDB Description: Crystal Structure of PaaI from Thermus thermophilus HB8

PDB Compounds: (B:) PaaI protein

SCOP Domain Sequences for d1j1yb_:

Sequence; same for both SEQRES and ATOM records:

>d1j1yb_ d.38.1.5 (B:) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

Timeline for d1j1yb_:

• d1j1yb_ first appeared in SCOP 1.67
  
• d1j1yb_ appears in SCOP 1.71
  
• d1j1yb_ appears in SCOP 1.75
  
• d1j1yb_ appears in the current release, SCOPe 2.08