Lineage for d1j1sa_ (1j1s A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420925Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 420926Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 420927Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 420957Protein Antiviral protein S [103333] (1 species)
    seed isoform
  7. 420958Species Pokeweed (Phytolacca americana) [TaxId:3527] [103334] (4 PDB entries)
  8. 420961Domain d1j1sa_: 1j1s A: [90770]
    complexed with fmp, nag

Details for d1j1sa_

PDB Entry: 1j1s (more details), 2 Å

PDB Description: pokeweed antiviral protein from seeds (pap-s1) complexed with formycin

SCOP Domain Sequences for d1j1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1sa_ d.165.1.1 (A:) Antiviral protein S {Pokeweed (Phytolacca americana)}
intitfdagnatinkyatfmeslrneakdpslkcygipmlpntnstikyllvklqgaslk
titlmlrrnnlyvmgysdpydnkcryhifndikgteysdventlcpssnprvakpinyng
lyptlekkagvtsrnevqlgiqilssdigkisgqgsftekieakfllvaiqmvseaarfk
yienqvktnfnrdfspndkvldleenwgkistaihnskngalpkplelknadgtkwivlr
vdeikpdvgllnyvngtcqat

SCOP Domain Coordinates for d1j1sa_:

Click to download the PDB-style file with coordinates for d1j1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1j1sa_: