Lineage for d1j1la_ (1j1l A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424349Family b.82.1.12: Pirin-like [101984] (3 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2424353Protein Pirin [101985] (1 species)
    Bcl-3 and nuclear factor I-interacting protein
  7. 2424354Species Human (Homo sapiens) [TaxId:9606] [101986] (9 PDB entries)
  8. 2424357Domain d1j1la_: 1j1l A: [90766]
    complexed with fe2

Details for d1j1la_

PDB Entry: 1j1l (more details), 2.1 Å

PDB Description: Crystal structure of human Pirin: a Bcl-3 and Nuclear factor I interacting protein and a cupin superfamily member
PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d1j1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}
sskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfe
tvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrs
sekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakh
sqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvlia
geplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

SCOPe Domain Coordinates for d1j1la_:

Click to download the PDB-style file with coordinates for d1j1la_.
(The format of our PDB-style files is described here.)

Timeline for d1j1la_: