SCOPe 2.05: Domain d1j1la_: 1j1l A:

Lineage for d1j1la_ (1j1l A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.12: Pirin-like [101984] (3 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Pirin [101985] (1 species)
   Bcl-3 and nuclear factor I-interacting protein

7. Species Human (Homo sapiens) [TaxId:9606] [101986] (7 PDB entries)

8. Domain d1j1la_: 1j1l A: [90766]
   complexed with fe2

Details for d1j1la_

PDB Entry: 1j1l, 2.1 Å

PDB Description: Crystal structure of human Pirin: a Bcl-3 and Nuclear factor I interacting protein and a cupin superfamily member

PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d1j1la_:

Sequence; same for both SEQRES and ATOM records:

>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}
sskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfe
tvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrs
sekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakh
sqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvlia
geplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

Timeline for d1j1la_:

• d1j1la_ first appeared in SCOP 1.67
  
• d1j1la_ appears in SCOPe 2.04
  
• d1j1la_ appears in SCOPe 2.06
  
• d1j1la_ appears in the current release, SCOPe 2.08