Lineage for d1j1jc_ (1j1j C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360174Superfamily a.118.16: Translin [74784] (1 family) (S)
  5. 360175Family a.118.16.1: Translin [74785] (1 protein)
  6. 360176Protein Translin [74786] (2 species)
    synonym: testis/brain RNA-binding protein, TB-RBP
  7. 360177Species Human (Homo sapiens) [TaxId:9606] [101419] (1 PDB entry)
  8. 360180Domain d1j1jc_: 1j1j C: [90764]

Details for d1j1jc_

PDB Entry: 1j1j (more details), 2.2 Å

PDB Description: Crystal Structure of human Translin

SCOP Domain Sequences for d1j1jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1jc_ a.118.16.1 (C:) Translin {Human (Homo sapiens)}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk
arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt
eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg
frllnlkndslrkrydglkydvkkveevvydlsirgf

SCOP Domain Coordinates for d1j1jc_:

Click to download the PDB-style file with coordinates for d1j1jc_.
(The format of our PDB-style files is described here.)

Timeline for d1j1jc_: