![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.16: Translin [74784] (2 families) ![]() automatically mapped to Pfam PF01997 |
![]() | Family a.118.16.1: Translin [74785] (2 proteins) |
![]() | Protein Translin [74786] (2 species) synonym: testis/brain RNA-binding protein, TB-RBP |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101419] (1 PDB entry) |
![]() | Domain d1j1jb_: 1j1j B: [90763] |
PDB Entry: 1j1j (more details), 2.2 Å
SCOPe Domain Sequences for d1j1jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1jb_ a.118.16.1 (B:) Translin {Human (Homo sapiens) [TaxId: 9606]} msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg frllnlkndslrkrydglkydvkkveevvydlsirgf
Timeline for d1j1jb_: