Lineage for d1j1jb_ (1j1j B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334416Superfamily a.118.16: Translin [74784] (2 families) (S)
    automatically mapped to Pfam PF01997
  5. 2334417Family a.118.16.1: Translin [74785] (2 proteins)
  6. 2334418Protein Translin [74786] (2 species)
    synonym: testis/brain RNA-binding protein, TB-RBP
  7. 2334419Species Human (Homo sapiens) [TaxId:9606] [101419] (1 PDB entry)
  8. 2334421Domain d1j1jb_: 1j1j B: [90763]

Details for d1j1jb_

PDB Entry: 1j1j (more details), 2.2 Å

PDB Description: Crystal Structure of human Translin
PDB Compounds: (B:) Translin

SCOPe Domain Sequences for d1j1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1jb_ a.118.16.1 (B:) Translin {Human (Homo sapiens) [TaxId: 9606]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk
arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt
eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg
frllnlkndslrkrydglkydvkkveevvydlsirgf

SCOPe Domain Coordinates for d1j1jb_:

Click to download the PDB-style file with coordinates for d1j1jb_.
(The format of our PDB-style files is described here.)

Timeline for d1j1jb_: