SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1j0xr1 (1j0x R:1-148,R:313-332)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2092282Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 protein domains)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2092523Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 2092638Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102158] (1 PDB entry)
  8. 2092642Domain d1j0xr1: 1j0x R:1-148,R:313-332 [90756]
    Other proteins in same PDB: d1j0xo2, d1j0xp2, d1j0xq2, d1j0xr2
    complexed with nad

Details for d1j0xr1

PDB Entry: 1j0x (more details), 2.4 Å

PDB Description: Crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
PDB Compounds: (R:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1j0xr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0xr1 c.2.1.3 (R:1-148,R:313-332) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
psadapmfvmgvnhekydnslkivsnasXnefgysnrvvdlmvhmaske

SCOPe Domain Coordinates for d1j0xr1:

Click to download the PDB-style file with coordinates for d1j0xr1.
(The format of our PDB-style files is described here.)

Timeline for d1j0xr1: