Lineage for d1j0xq2 (1j0x Q:149-312)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606543Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 606585Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 606702Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [103102] (1 PDB entry)
  8. 606705Domain d1j0xq2: 1j0x Q:149-312 [90755]
    Other proteins in same PDB: d1j0xo1, d1j0xp1, d1j0xq1, d1j0xr1

Details for d1j0xq2

PDB Entry: 1j0x (more details), 2.4 Å

PDB Description: crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (gapdh)

SCOP Domain Sequences for d1j0xq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0xq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus)}
cttnclaplakvihdhfgiveglmttvhaitatqktvdgpsgklwrdgrgaaqniipast
gaakavgkvipelngkltgmafrvptpnvsvvdltcrlekaakyddikkvvkqasegplk
gilgytedqvvscdfnsdthsstfdagagialndhfvkliswyd

SCOP Domain Coordinates for d1j0xq2:

Click to download the PDB-style file with coordinates for d1j0xq2.
(The format of our PDB-style files is described here.)

Timeline for d1j0xq2: