SCOPe 2.02: Domain d1j0xq1: 1j0x Q:1-148,Q:313-332

Lineage for d1j0xq1 (1j0x Q:1-148,Q:313-332)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102158] (1 PDB entry)

8. Domain d1j0xq1: 1j0x Q:1-148,Q:313-332 [90754]
   Other proteins in same PDB: d1j0xo2, d1j0xp2, d1j0xq2, d1j0xr2
   complexed with nad

Details for d1j0xq1

PDB Entry: 1j0x, 2.4 Å

PDB Description: crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (gapdh)

PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1j0xq1:

Sequence; same for both SEQRES and ATOM records:

>d1j0xq1 c.2.1.3 (Q:1-148,Q:313-332) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
psadapmfvmgvnhekydnslkivsnasXnefgysnrvvdlmvhmaske

Timeline for d1j0xq1:

• d1j0xq1 first appeared in SCOP 1.67
  
• d1j0xq1 appears in SCOPe 2.01
  
• d1j0xq1 appears in SCOPe 2.03
  
• d1j0xq1 appears in the current release, SCOPe 2.08