Lineage for d1j0xp1 (1j0x P:1-148,P:313-332)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843784Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2843909Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102158] (1 PDB entry)
  8. 2843911Domain d1j0xp1: 1j0x P:1-148,P:313-332 [90752]
    Other proteins in same PDB: d1j0xo2, d1j0xp2, d1j0xq2, d1j0xr2
    complexed with nad

Details for d1j0xp1

PDB Entry: 1j0x (more details), 2.4 Å

PDB Description: crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (gapdh)
PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1j0xp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0xp1 c.2.1.3 (P:1-148,P:313-332) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vkvgvngfgrigrlvtraafnsgkvdvvaindpfidlhymvymfqydsthgkfhgtvkae
ngklvingkaitifqerdpanikwgdagaeyvvestgvfttmekagahlkggakrviisa
psadapmfvmgvnhekydnslkivsnasXnefgysnrvvdlmvhmaske

SCOPe Domain Coordinates for d1j0xp1:

Click to download the PDB-style file with coordinates for d1j0xp1.
(The format of our PDB-style files is described here.)

Timeline for d1j0xp1: