Lineage for d1j0xo2 (1j0x O:149-312)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568241Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2568332Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2568457Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [103102] (1 PDB entry)
  8. 2568458Domain d1j0xo2: 1j0x O:149-312 [90751]
    Other proteins in same PDB: d1j0xo1, d1j0xp1, d1j0xq1, d1j0xr1
    complexed with nad

Details for d1j0xo2

PDB Entry: 1j0x (more details), 2.4 Å

PDB Description: crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (gapdh)
PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1j0xo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0xo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
cttnclaplakvihdhfgiveglmttvhaitatqktvdgpsgklwrdgrgaaqniipast
gaakavgkvipelngkltgmafrvptpnvsvvdltcrlekaakyddikkvvkqasegplk
gilgytedqvvscdfnsdthsstfdagagialndhfvkliswyd

SCOPe Domain Coordinates for d1j0xo2:

Click to download the PDB-style file with coordinates for d1j0xo2.
(The format of our PDB-style files is described here.)

Timeline for d1j0xo2: