Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [103102] (1 PDB entry) |
Domain d1j0xo2: 1j0x O:149-312 [90751] Other proteins in same PDB: d1j0xo1, d1j0xp1, d1j0xq1, d1j0xr1 complexed with nad |
PDB Entry: 1j0x (more details), 2.4 Å
SCOPe Domain Sequences for d1j0xo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0xo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} cttnclaplakvihdhfgiveglmttvhaitatqktvdgpsgklwrdgrgaaqniipast gaakavgkvipelngkltgmafrvptpnvsvvdltcrlekaakyddikkvvkqasegplk gilgytedqvvscdfnsdthsstfdagagialndhfvkliswyd
Timeline for d1j0xo2: