SCOPe 2.03: Domain d1j0xo2: 1j0x O:149-312

Lineage for d1j0xo2 (1j0x O:149-312)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [103102] (1 PDB entry)

8. Domain d1j0xo2: 1j0x O:149-312 [90751]
   Other proteins in same PDB: d1j0xo1, d1j0xp1, d1j0xq1, d1j0xr1
   complexed with nad

Details for d1j0xo2

PDB Entry: 1j0x, 2.4 Å

PDB Description: crystal structure of the rabbit muscle glyceraldehyde-3-phosphate dehydrogenase (gapdh)

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1j0xo2:

Sequence; same for both SEQRES and ATOM records:

>d1j0xo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
cttnclaplakvihdhfgiveglmttvhaitatqktvdgpsgklwrdgrgaaqniipast
gaakavgkvipelngkltgmafrvptpnvsvvdltcrlekaakyddikkvvkqasegplk
gilgytedqvvscdfnsdthsstfdagagialndhfvkliswyd

Timeline for d1j0xo2:

• d1j0xo2 first appeared in SCOP 1.67
  
• d1j0xo2 appears in SCOPe 2.02
  
• d1j0xo2 appears in SCOPe 2.04
  
• d1j0xo2 appears in the current release, SCOPe 2.08