Lineage for d1j0wb_ (1j0w B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551068Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1551093Protein Downstream of tyrosine kinase 5, Dok-5 [101832] (1 species)
  7. 1551094Species Human (Homo sapiens) [TaxId:9606] [101833] (1 PDB entry)
  8. 1551096Domain d1j0wb_: 1j0w B: [90749]

Details for d1j0wb_

PDB Entry: 1j0w (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of the Dok-5 PTB Domain
PDB Compounds: (B:) downstream of tyrosine kinase 5

SCOPe Domain Sequences for d1j0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0wb_ b.55.1.2 (B:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]}
reqserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdtt
wftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeler

SCOPe Domain Coordinates for d1j0wb_:

Click to download the PDB-style file with coordinates for d1j0wb_.
(The format of our PDB-style files is described here.)

Timeline for d1j0wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j0wa_