SCOPe 2.01: Domain d1j0wa_: 1j0w A:

Lineage for d1j0wa_ (1j0w A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Downstream of tyrosine kinase 5, Dok-5 [101832] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101833] (1 PDB entry)

8. Domain d1j0wa_: 1j0w A: [90748]

Details for d1j0wa_

PDB Entry: 1j0w, 2.5 Å

PDB Description: Crystal Structure Analysis of the Dok-5 PTB Domain

PDB Compounds: (A:) downstream of tyrosine kinase 5

SCOPe Domain Sequences for d1j0wa_:

Sequence; same for both SEQRES and ATOM records:

>d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]}
qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf
tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiael

Timeline for d1j0wa_:

• d1j0wa_ first appeared in SCOP 1.67
  
• d1j0wa_ appears in SCOP 1.75
  
• d1j0wa_ appears in SCOPe 2.02
  
• d1j0wa_ appears in the current release, SCOPe 2.08, called d1j0wa1