SCOP 1.67: Domain d1j0wa_: 1j0w A:

Lineage for d1j0wa_ (1j0w A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (8 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)

6. Protein Downstream of tyrosine kinase 5, Dok-5 [101832] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101833] (1 PDB entry)

8. Domain d1j0wa_: 1j0w A: [90748]

Details for d1j0wa_

PDB Entry: 1j0w, 2.5 Å

PDB Description: Crystal Structure Analysis of the Dok-5 PTB Domain

SCOP Domain Sequences for d1j0wa_:

Sequence; same for both SEQRES and ATOM records:

>d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens)}
qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf
tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiael

Timeline for d1j0wa_:

• d1j0wa_ is new in SCOP 1.67
  
• d1j0wa_ appears in SCOP 1.69
  
• d1j0wa_ appears in the current release, SCOPe 2.08, called d1j0wa1