Class b: All beta proteins [48724] (141 folds) |
Fold b.55: PH domain-like [50728] (1 superfamily) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (8 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins) |
Protein Downstream of tyrosine kinase 5, Dok-5 [101832] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101833] (1 PDB entry) |
Domain d1j0wa_: 1j0w A: [90748] |
PDB Entry: 1j0w (more details), 2.5 Å
SCOP Domain Sequences for d1j0wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens)} qserfnvylmpspnldvhgecalqityeyiclwdvqnprvkliswplsalrrygrdttwf tfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiael
Timeline for d1j0wa_: