Lineage for d1j0sa_ (1j0s A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464259Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 464393Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)
  6. 464404Protein Interleukin-18 [101782] (1 species)
  7. 464405Species Human (Homo sapiens) [TaxId:9606] [101783] (1 PDB entry)
  8. 464406Domain d1j0sa_: 1j0s A: [90747]

Details for d1j0sa_

PDB Entry: 1j0s (more details)

PDB Description: solution structure of the human interleukin-18

SCOP Domain Sequences for d1j0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0sa_ b.42.1.2 (A:) Interleukin-18 {Human (Homo sapiens)}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflacekerdlfklilkkedelgdrsimftvqned

SCOP Domain Coordinates for d1j0sa_:

Click to download the PDB-style file with coordinates for d1j0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1j0sa_: