SCOPe 2.08: Domain d1j0ra_: 1j0r A:

Lineage for d1j0ra_ (1j0r A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
   automatically mapped to Pfam PF02334

6. Protein Replication terminator protein (RTP) [46808] (1 species)
   contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer

7. Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)

8. Domain d1j0ra_: 1j0r A: [90745]
   mutant

Details for d1j0ra_

PDB Entry: 1j0r, 2.5 Å

PDB Description: crystal structure of the replication termination protein mutant c110s

PDB Compounds: (A:) Replication termination protein

SCOPe Domain Sequences for d1j0ra_:

Sequence; same for both SEQRES and ATOM records:

>d1j0ra_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
tgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhellddg
ilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

Timeline for d1j0ra_:

• d1j0ra_ first appeared in SCOP 1.67
  
• d1j0ra_ appears in SCOPe 2.07