Lineage for d1j0ga1 (1j0g A:8-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.6: BM-002-like [75362] (3 proteins)
    Pfam PF03671; UPF0185; this family comprises small uncharacterized proteins including human protein BM-002
  6. Protein Hypothetical protein 1810045k17 [102788] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [102789] (1 PDB entry)
  8. Domain d1j0ga1: 1j0g A:8-92 [90740]
    Other proteins in same PDB: d1j0ga2
    structural genomics

Details for d1j0ga1

PDB Entry: 1j0g (more details)

PDB Description: Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold
PDB Compounds: (A:) Hypothetical Protein 1810045K17

SCOPe Domain Sequences for d1j0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ga1 d.15.1.6 (A:8-92) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]}
mskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpa
qtagnvflkhgselriiprdrvgsc

SCOPe Domain Coordinates for d1j0ga1 are not available.

Timeline for d1j0ga1:

Domains from same chain:
(mouse over for more information)
d1j0ga2