Lineage for d1j0fa_ (1j0f A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854286Family c.47.1.14: SH3BGR (SH3-binding, glutamic acid-rich protein-like) [102446] (2 protein domains)
    related to glutaredoxin 1 (GRX1) but lacks both conserved cysteine residues
    automatically mapped to Pfam PF04908
  6. 1854287Protein SH3BGRL3 [102447] (1 species)
  7. 1854288Species Mouse (Mus musculus) [TaxId:10090] [102448] (2 PDB entries)
    Uniprot Q91VW3
  8. 1854291Domain d1j0fa_: 1j0f A: [90739]

Details for d1j0fa_

PDB Entry: 1j0f (more details)

PDB Description: Solution Structure of the SH3 Domain Binding Glutamic Acid-rich Protein Like 3
PDB Compounds: (A:) SH3 domain-binding glutamic acid-rich-like protein 3

SCOPe Domain Sequences for d1j0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0fa_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]}
gsegaatmsglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtl
agnpkatppqivngnhycgdyelfveaveqdtlqeflkla

SCOPe Domain Coordinates for d1j0fa_:

Click to download the PDB-style file with coordinates for d1j0fa_.
(The format of our PDB-style files is described here.)

Timeline for d1j0fa_: