Lineage for d1j04a_ (1j04 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147545Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2147557Protein Alanine-glyoxylate aminotransferase [89757] (3 species)
  7. 2147560Species Human (Homo sapiens) [TaxId:9606] [89758] (3 PDB entries)
  8. 2147562Domain d1j04a_: 1j04 A: [90734]
    complexed with aoa, gol

Details for d1j04a_

PDB Entry: 1j04 (more details), 2.6 Å

PDB Description: structural mechanism of enzyme mistargeting in hereditary kidney stone disease in vitro
PDB Compounds: (A:) alanine--glyoxylate aminotransferase

SCOPe Domain Sequences for d1j04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j04a_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
hkllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikeg
iqyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarv
hpmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfrelchrykclllvd
svaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyld
ikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlq
alglqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigl
lgcnatrenvdrvtealraalqhcpkk

SCOPe Domain Coordinates for d1j04a_:

Click to download the PDB-style file with coordinates for d1j04a_.
(The format of our PDB-style files is described here.)

Timeline for d1j04a_: