Lineage for d1j03a1 (1j03 A:1-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212846Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2212847Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2212952Family d.120.1.2: Steroid-binding domain [103222] (1 protein)
  6. 2212953Protein Putative steroid binding protein AT2G24940 [103223] (1 species)
  7. 2212954Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103224] (3 PDB entries)
  8. 2212957Domain d1j03a1: 1j03 A:1-100 [90733]
    Other proteins in same PDB: d1j03a2
    structural genomics

Details for d1j03a1

PDB Entry: 1j03 (more details)

PDB Description: Solution structure of a putative steroid-binding protein from Arabidopsis
PDB Compounds: (A:) putative steroid binding protein

SCOPe Domain Sequences for d1j03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j03a1 d.120.1.2 (A:1-100) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkdasralgkms
kneedvspslegltekeintlndwetkfeakypvvgrvvs

SCOPe Domain Coordinates for d1j03a1:

Click to download the PDB-style file with coordinates for d1j03a1.
(The format of our PDB-style files is described here.)

Timeline for d1j03a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j03a2