Lineage for d1j03a_ (1j03 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417732Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 417733Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) (S)
  5. 417798Family d.120.1.2: Steroid-binding domain [103222] (1 protein)
  6. 417799Protein Putative steroid binding protein AT2G24940 [103223] (1 species)
  7. 417800Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103224] (2 PDB entries)
  8. 417802Domain d1j03a_: 1j03 A: [90733]
    structural genomics

Details for d1j03a_

PDB Entry: 1j03 (more details)

PDB Description: solution structure of a putative steroid-binding protein from arabidopsis

SCOP Domain Sequences for d1j03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j03a_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana)}
gpmeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkdasralgk
mskneedvspslegltekeintlndwetkfeakypvvgrvvs

SCOP Domain Coordinates for d1j03a_:

Click to download the PDB-style file with coordinates for d1j03a_.
(The format of our PDB-style files is described here.)

Timeline for d1j03a_: