Lineage for d1izza_ (1izz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117924Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2117995Protein HSP31 (HchA; YedU) [89609] (1 species)
    contains a buried Cys-His-Asp triad within one subunit
  7. 2117996Species Escherichia coli [TaxId:562] [89610] (5 PDB entries)
  8. 2117999Domain d1izza_: 1izz A: [90731]

Details for d1izza_

PDB Entry: 1izz (more details), 2.31 Å

PDB Description: crystal structure of hsp31
PDB Compounds: (A:) Hsp31

SCOPe Domain Sequences for d1izza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izza_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]}
sknpqvdiaednaffpseyslsqytspvsdldgvdypkpyrgkhkilviaaderylptdn
gklfstgnhpietllplyhlhaagfefevatisglmtkfeywampqkdekvmpffeqhks
lfrnpkkladvvaslnadseyaaifvpgghgaliglpesqdvaaalqwaikndrfvisld
hgpaaflalrhgdnplngysicafpdaadkqtpeigympghltwyfgeelkkmgmniind
ditgrvhkdrklltgdspfaanalgklaaqemlaay

SCOPe Domain Coordinates for d1izza_:

Click to download the PDB-style file with coordinates for d1izza_.
(The format of our PDB-style files is described here.)

Timeline for d1izza_: