Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein HSP31 (HchA; YedU) [89609] (1 species) contains a buried Cys-His-Asp triad within one subunit |
Species Escherichia coli [TaxId:562] [89610] (5 PDB entries) |
Domain d1izza_: 1izz A: [90731] |
PDB Entry: 1izz (more details), 2.31 Å
SCOPe Domain Sequences for d1izza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izza_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} sknpqvdiaednaffpseyslsqytspvsdldgvdypkpyrgkhkilviaaderylptdn gklfstgnhpietllplyhlhaagfefevatisglmtkfeywampqkdekvmpffeqhks lfrnpkkladvvaslnadseyaaifvpgghgaliglpesqdvaaalqwaikndrfvisld hgpaaflalrhgdnplngysicafpdaadkqtpeigympghltwyfgeelkkmgmniind ditgrvhkdrklltgdspfaanalgklaaqemlaay
Timeline for d1izza_: