SCOP 1.71: Domain d1izza_: 1izz A:

Lineage for d1izza_ (1izz A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (7 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein HSP31 (HchA; YedU) [89609] (1 species)
   contains a buried Cys-His-Asp triad within one subunit

7. Species Escherichia coli [TaxId:562] [89610] (5 PDB entries)

8. Domain d1izza_: 1izz A: [90731]

Details for d1izza_

PDB Entry: 1izz, 2.31 Å

PDB Description: crystal structure of hsp31

SCOP Domain Sequences for d1izza_:

Sequence; same for both SEQRES and ATOM records:

>d1izza_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli}
sknpqvdiaednaffpseyslsqytspvsdldgvdypkpyrgkhkilviaaderylptdn
gklfstgnhpietllplyhlhaagfefevatisglmtkfeywampqkdekvmpffeqhks
lfrnpkkladvvaslnadseyaaifvpgghgaliglpesqdvaaalqwaikndrfvisld
hgpaaflalrhgdnplngysicafpdaadkqtpeigympghltwyfgeelkkmgmniind
ditgrvhkdrklltgdspfaanalgklaaqemlaay

Timeline for d1izza_:

• d1izza_ first appeared in SCOP 1.67
  
• d1izza_ appears in SCOP 1.69
  
• d1izza_ appears in SCOP 1.73
  
• d1izza_ appears in the current release, SCOPe 2.08