Lineage for d1izma_ (1izm A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362523Fold a.199: YgfB-like [101326] (1 superfamily)
    multihelical; consists of two tightly associated 3-helical bundles with different twists
  4. 362524Superfamily a.199.1: YgfB-like [101327] (1 family) (S)
  5. 362525Family a.199.1.1: YgfB-like [101328] (1 protein)
  6. 362526Protein Hypothetical protein HI0817 [101329] (1 species)
  7. 362527Species Haemophilus influenzae [TaxId:727] [101330] (1 PDB entry)
  8. 362528Domain d1izma_: 1izm A: [90725]
    structural genomics
    mutant

Details for d1izma_

PDB Entry: 1izm (more details), 1.95 Å

PDB Description: structure of ygfb from haemophilus influenzae (hi0817), a conserved hypothetical protein

SCOP Domain Sequences for d1izma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izma_ a.199.1.1 (A:) Hypothetical protein HI0817 {Haemophilus influenzae}
lishsdmnqqlksagigfnatelhgflsgllcgglkdqswlpllyqfsndnhayptglvq
pvtelyeqisqtlsdvegftfelgltedenvftqadslsdwanqfllgiglaqpelakek
geigeavddlqdicqlgydeddneeelaealeeiieyvrtiamlfyshfn

SCOP Domain Coordinates for d1izma_:

Click to download the PDB-style file with coordinates for d1izma_.
(The format of our PDB-style files is described here.)

Timeline for d1izma_: