Lineage for d1izma_ (1izm A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.199: YgfB-like [101326] (1 superfamily)
    multihelical; consists of two tightly associated 3-helical bundles with different twists
  4. Superfamily a.199.1: YgfB-like [101327] (1 family) (S)
    automatically mapped to Pfam PF03695
  5. Family a.199.1.1: YgfB-like [101328] (1 protein)
  6. Protein Hypothetical protein HI0817 [101329] (1 species)
  7. Species Haemophilus influenzae [TaxId:727] [101330] (1 PDB entry)
  8. Domain d1izma_: 1izm A: [90725]
    structural genomics

Details for d1izma_

PDB Entry: 1izm (more details), 1.95 Å

PDB Description: Structure of ygfB from Haemophilus influenzae (HI0817), a Conserved Hypothetical Protein
PDB Compounds: (A:) hypothetical protein hi0817

SCOPe Domain Sequences for d1izma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izma_ a.199.1.1 (A:) Hypothetical protein HI0817 {Haemophilus influenzae [TaxId: 727]}
lishsdmnqqlksagigfnatelhgflsgllcgglkdqswlpllyqfsndnhayptglvq
pvtelyeqisqtlsdvegftfelgltedenvftqadslsdwanqfllgiglaqpelakek
geigeavddlqdicqlgydeddneeelaealeeiieyvrtiamlfyshfn

SCOPe Domain Coordinates for d1izma_ are not available.

Timeline for d1izma_: