Lineage for d1izma_ (1izm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341885Fold a.199: YgfB-like [101326] (1 superfamily)
    multihelical; consists of two tightly associated 3-helical bundles with different twists
  4. 2341886Superfamily a.199.1: YgfB-like [101327] (1 family) (S)
    automatically mapped to Pfam PF03695
  5. 2341887Family a.199.1.1: YgfB-like [101328] (1 protein)
  6. 2341888Protein Hypothetical protein HI0817 [101329] (1 species)
  7. 2341889Species Haemophilus influenzae [TaxId:727] [101330] (1 PDB entry)
  8. 2341890Domain d1izma_: 1izm A: [90725]
    structural genomics

Details for d1izma_

PDB Entry: 1izm (more details), 1.95 Å

PDB Description: Structure of ygfB from Haemophilus influenzae (HI0817), a Conserved Hypothetical Protein
PDB Compounds: (A:) hypothetical protein hi0817

SCOPe Domain Sequences for d1izma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izma_ a.199.1.1 (A:) Hypothetical protein HI0817 {Haemophilus influenzae [TaxId: 727]}
lishsdmnqqlksagigfnatelhgflsgllcgglkdqswlpllyqfsndnhayptglvq
pvtelyeqisqtlsdvegftfelgltedenvftqadslsdwanqfllgiglaqpelakek
geigeavddlqdicqlgydeddneeelaealeeiieyvrtiamlfyshfn

SCOPe Domain Coordinates for d1izma_:

Click to download the PDB-style file with coordinates for d1izma_.
(The format of our PDB-style files is described here.)

Timeline for d1izma_: