Lineage for d1iysa_ (1iys A:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617469Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 617470Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 617471Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)
  6. 617555Protein beta-Lactamase, class A [56606] (15 species)
  7. 617601Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (5 PDB entries)
  8. 617602Domain d1iysa_: 1iys A: [90723]
    complexed with so4

Details for d1iysa_

PDB Entry: 1iys (more details), 1.65 Å

PDB Description: Crystal Structure of Class A beta-Lactamase Toho-1

SCOP Domain Sequences for d1iysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iysa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaerrrdilaaaakivthgf

SCOP Domain Coordinates for d1iysa_:

Click to download the PDB-style file with coordinates for d1iysa_.
(The format of our PDB-style files is described here.)

Timeline for d1iysa_: