Lineage for d1iyna_ (1iyn A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358328Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358329Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 358330Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 358331Protein Ascorbate peroxidase [48123] (3 species)
  7. 358332Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101336] (1 PDB entry)
    chloroplastic isoform
  8. 358333Domain d1iyna_: 1iyn A: [90722]
    complexed with hem, na

Details for d1iyna_

PDB Entry: 1iyn (more details), 1.6 Å

PDB Description: Crystal structure of chloroplastic ascorbate peroxidase from tobacco plants and structural insights for its instability

SCOP Domain Sequences for d1iyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum)}
aasdsaqlksaredikellktkfchpimvrlgwhdagtynknieewpqrggangslrfdv
elkhganaglvnalnllkpikdkysgvtyadlfqlasataieeaggpkipmkygrvdvte
peqcpeegrlpdagppspaqhlrdvfyrmglndkeivalsgahtlgrsrpdrsgwgkpet
kytkdgpgapggqswtaqwlkfdnsyfkdikerrdedllvlptdaalfedpsfkvyaeky
aadpeaffkdyaeahaklsnlgakfgpaegfsleg

SCOP Domain Coordinates for d1iyna_:

Click to download the PDB-style file with coordinates for d1iyna_.
(The format of our PDB-style files is described here.)

Timeline for d1iyna_: