Class a: All alpha proteins [46456] (202 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) |
Family a.93.1.1: CCP-like [48114] (4 proteins) |
Protein Ascorbate peroxidase [48123] (3 species) |
Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101336] (1 PDB entry) chloroplastic isoform |
Domain d1iyna_: 1iyn A: [90722] complexed with hem, na |
PDB Entry: 1iyn (more details), 1.6 Å
SCOP Domain Sequences for d1iyna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum)} aasdsaqlksaredikellktkfchpimvrlgwhdagtynknieewpqrggangslrfdv elkhganaglvnalnllkpikdkysgvtyadlfqlasataieeaggpkipmkygrvdvte peqcpeegrlpdagppspaqhlrdvfyrmglndkeivalsgahtlgrsrpdrsgwgkpet kytkdgpgapggqswtaqwlkfdnsyfkdikerrdedllvlptdaalfedpsfkvyaeky aadpeaffkdyaeahaklsnlgakfgpaegfsleg
Timeline for d1iyna_: