SCOPe 2.07: Domain d1iybb1: 1iyb B:1-204

Lineage for d1iybb1 (1iyb B:1-204)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)

6. Protein RNase NW [103230] (1 species)

7. Species Nicotiana glutinosa [TaxId:35889] [103231] (1 PDB entry)

8. Domain d1iybb1: 1iyb B:1-204 [90721]
   Other proteins in same PDB: d1iyba2, d1iybb2
   complexed with 5gp

Details for d1iybb1

PDB Entry: 1iyb, 1.5 Å

PDB Description: Crystal Structure of the Nicotiana glutinosa Ribonuclease NW

PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d1iybb1:

Sequence; same for both SEQRES and ATOM records:

>d1iybb1 d.124.1.1 (B:1-204) RNase NW {Nicotiana glutinosa [TaxId: 35889]}
aqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncdsnspy
dqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkaldlknq
inlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyicvdgs
gsnliecpifprgkcgssiefptf

Timeline for d1iybb1:

• d1iybb1 first appeared in SCOP 1.67, called d1iybb_
  
• d1iybb1 appears in SCOPe 2.06
  
• d1iybb1 appears in the current release, SCOPe 2.08