Lineage for d1iybb_ (1iyb B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610392Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 610393Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 610394Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins)
  6. 610416Protein RNase NW [103230] (1 species)
  7. 610417Species Tobacco (Nicotiana glutinosa) [103231] (1 PDB entry)
  8. 610419Domain d1iybb_: 1iyb B: [90721]
    complexed with 5gp

Details for d1iybb_

PDB Entry: 1iyb (more details), 1.5 Å

PDB Description: Crystal Structure of the Nicotiana glutinosa Ribonuclease NW

SCOP Domain Sequences for d1iybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iybb_ d.124.1.1 (B:) RNase NW {Tobacco (Nicotiana glutinosa)}
yvefaqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncds
nspydqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkald
lknqinlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyic
vdgsgsnliecpifprgkcgssiefptf

SCOP Domain Coordinates for d1iybb_:

Click to download the PDB-style file with coordinates for d1iybb_.
(The format of our PDB-style files is described here.)

Timeline for d1iybb_: