Lineage for d1iyba1 (1iyb A:1-204)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213747Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2213748Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2213749Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2213771Protein RNase NW [103230] (1 species)
  7. 2213772Species Nicotiana glutinosa [TaxId:35889] [103231] (1 PDB entry)
  8. 2213773Domain d1iyba1: 1iyb A:1-204 [90720]
    Other proteins in same PDB: d1iyba2, d1iybb2
    complexed with 5gp

Details for d1iyba1

PDB Entry: 1iyb (more details), 1.5 Å

PDB Description: Crystal Structure of the Nicotiana glutinosa Ribonuclease NW
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1iyba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyba1 d.124.1.1 (A:1-204) RNase NW {Nicotiana glutinosa [TaxId: 35889]}
aqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncdsnspy
dqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkaldlknq
inlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyicvdgs
gsnliecpifprgkcgssiefptf

SCOPe Domain Coordinates for d1iyba1:

Click to download the PDB-style file with coordinates for d1iyba1.
(The format of our PDB-style files is described here.)

Timeline for d1iyba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyba2