Lineage for d1iyba_ (1iyb A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510590Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 510591Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 510592Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins)
  6. 510613Protein RNase NW [103230] (1 species)
  7. 510614Species Tobacco (Nicotiana glutinosa) [103231] (1 PDB entry)
  8. 510615Domain d1iyba_: 1iyb A: [90720]

Details for d1iyba_

PDB Entry: 1iyb (more details), 1.5 Å

PDB Description: Crystal Structure of the Nicotiana glutinosa Ribonuclease NW

SCOP Domain Sequences for d1iyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyba_ d.124.1.1 (A:) RNase NW {Tobacco (Nicotiana glutinosa)}
yvefaqdfdffyfvqqwpgsycdtkqsccypktgkpasdfgihglwpnnndgsypsncds
nspydqsqvsdlisrmqqnwptlacpsgtgsafwshewekhgtcaenvfdqhgyfkkald
lknqinlleilqgagihpdggfyslnsiknairsaigyapgiecnvdesgnsqlyqiyic
vdgsgsnliecpifprgkcgssiefptf

SCOP Domain Coordinates for d1iyba_:

Click to download the PDB-style file with coordinates for d1iyba_.
(The format of our PDB-style files is described here.)

Timeline for d1iyba_: