SCOPe 2.06: Domain d1ixva1: 1ixv A:3-228

Lineage for d1ixva1 (1ixv A:3-228)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (1 PDB entry)

8. Domain d1ixva1: 1ixv A:3-228 [90719]
   Other proteins in same PDB: d1ixva2

Details for d1ixva1

PDB Entry: 1ixv, 2.3 Å

PDB Description: Crystal Structure Analysis of homolog of oncoprotein gankyrin, an interactor of Rb and CDK4/6

PDB Compounds: (A:) Probable 26S proteasome regulatory subunit p28

SCOPe Domain Sequences for d1ixva1:

Sequence; same for both SEQRES and ATOM records:

>d1ixva1 d.211.1.1 (A:3-228) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv

Timeline for d1ixva1:

• d1ixva1 first appeared in SCOP 1.67, called d1ixva_
  
• d1ixva1 was called d1ixva_ in SCOPe 2.05
  
• d1ixva1 appears in SCOPe 2.07
  
• d1ixva1 appears in the current release, SCOPe 2.08