Lineage for d1ixva_ (1ixv A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422776Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 422777Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 422778Family d.211.1.1: Ankyrin repeat [48404] (14 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 422779Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (2 species)
  7. 422780Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (1 PDB entry)
  8. 422781Domain d1ixva_: 1ixv A: [90719]

Details for d1ixva_

PDB Entry: 1ixv (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of homolog of oncoprotein gankyrin, an interactor of Rb and CDK4/6

SCOP Domain Sequences for d1ixva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae)}
nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvda

SCOP Domain Coordinates for d1ixva_:

Click to download the PDB-style file with coordinates for d1ixva_.
(The format of our PDB-style files is described here.)

Timeline for d1ixva_: