Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (1 family) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (14 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (1 PDB entry) |
Domain d1ixva_: 1ixv A: [90719] |
PDB Entry: 1ixv (more details), 2.3 Å
SCOP Domain Sequences for d1ixva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae)} nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvda
Timeline for d1ixva_: