Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (1 PDB entry) |
Domain d1ixva1: 1ixv A:3-228 [90719] Other proteins in same PDB: d1ixva2 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1ixv (more details), 2.3 Å
SCOPe Domain Sequences for d1ixva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixva1 d.211.1.1 (A:3-228) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
Timeline for d1ixva1: