Lineage for d1ixla_ (1ixl A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601788Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 601789Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 601873Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)
  6. 601892Protein Hypothetical protein PH1136 [102916] (1 species)
  7. 601893Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102917] (1 PDB entry)
  8. 601894Domain d1ixla_: 1ixl A: [90717]
    structural genomics

Details for d1ixla_

PDB Entry: 1ixl (more details), 1.94 Å

PDB Description: Crystal structure of uncharacterized protein PH1136 from Pyrococcus horikoshii

SCOP Domain Sequences for d1ixla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii}
mipveqrthkltsrilvgkpilikegyaeveletidemkvdekglvhggftfgladyaam
lavneptvvlgkaevrftkpvkvgdklvakakiiedlgkkkivevkvyreeevvlegkfy
cyvlekhvld

SCOP Domain Coordinates for d1ixla_:

Click to download the PDB-style file with coordinates for d1ixla_.
(The format of our PDB-style files is described here.)

Timeline for d1ixla_: