Lineage for d1ixka_ (1ixk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130236Family c.66.1.38: NOL1/NOP2/sun [102575] (3 protein domains)
    Pfam PF01189; contains additional N-terminal 3-helical and ferredoxin-like domains
  6. 2130237Protein Hypothetical methyltransferase PH1374 [102576] (1 species)
  7. 2130238Species Pyrococcus horikoshii [TaxId:53953] [102577] (1 PDB entry)
  8. 2130239Domain d1ixka_: 1ixk A: [90716]

Details for d1ixka_

PDB Entry: 1ixk (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Methyltransferase Homolog Protein from Pyrococcus Horikoshii
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d1ixka_:

Sequence, based on SEQRES records: (download)

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Pyrococcus horikoshii [TaxId: 53953]}
lspsmldkllrlgysklfadryfqlwgerairiaeamekplprcfrvntlkisvqdlvkr
lnkkgfqfkrvpwakegfcltrepfsitstpefltgliyiqeassmyppvaldpkpgeiv
admaaapggktsylaqlmrndgviyafdvdenrlretrlnlsrlgvlnvilfhssslhig
elnvefdkilldapctgsgtihknperkwnrtmddikfcqglqmrllekglevlkpggil
vystcslepeenefviqwaldnfdvellplkygepaltnpfgielseeiknarrlypdvh
etsgffiakirkl

Sequence, based on observed residues (ATOM records): (download)

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Pyrococcus horikoshii [TaxId: 53953]}
lspsmldkllrlgysklfadryfqlwgerairiaeamekplprcfrvntlkisvqdlvkr
lnkkgfqfkrvpwakegfcltrepfsitstpefltgliyiqeassmyppvaldpkpgeiv
admaaapggktsylaqlmrndgviyafdvdenrlretrlnlsrlgvlnvilfhssslhig
elnvefdkilldapctgsgtihrtmddikfcqglqmrllekglevlkpggilvystcsle
peenefviqwaldnfdvellplkygepaltnpfgielseeiknarrlypdvhetsgffia
kirkl

SCOPe Domain Coordinates for d1ixka_:

Click to download the PDB-style file with coordinates for d1ixka_.
(The format of our PDB-style files is described here.)

Timeline for d1ixka_: