SCOPe 2.06: Domain d1ix1b1: 1ix1 B:2-168

Lineage for d1ix1b1 (1ix1 B:2-168)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [75578] (4 PDB entries)

8. Domain d1ix1b1: 1ix1 B:2-168 [90713]
   Other proteins in same PDB: d1ix1a2, d1ix1b2
   complexed with antibiotic actinonin
   complexed with bb2, mha, zn

Details for d1ix1b1

PDB Entry: 1ix1, 1.85 Å

PDB Description: Crystal Structure of P.aeruginosa Peptide deformylase Complexed with Antibiotic Actinonin

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d1ix1b1:

Sequence; same for both SEQRES and ATOM records:

>d1ix1b1 d.167.1.1 (B:2-168) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]}
ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
dlsedkseprvfinpefepltedmdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqqa

Timeline for d1ix1b1:

• d1ix1b1 first appeared in SCOP 1.67, called d1ix1b_
  
• d1ix1b1 was called d1ix1b_ in SCOPe 2.05
  
• d1ix1b1 appears in SCOPe 2.07
  
• d1ix1b1 appears in the current release, SCOPe 2.08