Lineage for d1iv9a_ (1iv9 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2504827Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2504828Family d.17.1.1: Monellin [54404] (2 protein domains)
  6. 2504829Protein Monellin, B & A chains together [54405] (1 species)
  7. 2504830Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)
  8. 2504839Domain d1iv9a_: 1iv9 A: [90709]
    single-chain version

Details for d1iv9a_

PDB Entry: 1iv9 (more details), 1.9 Å

PDB Description: crystal structure of single chain monellin
PDB Compounds: (A:) monellin

SCOPe Domain Sequences for d1iv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv9a_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeengfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d1iv9a_:

Click to download the PDB-style file with coordinates for d1iv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1iv9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iv9b_