Lineage for d1iv7b_ (1iv7 B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 408885Superfamily d.17.1: Cystatin/monellin [54403] (3 families) (S)
    has a additional strand at the N-terminus
  5. 408886Family d.17.1.1: Monellin [54404] (1 protein)
  6. 408887Protein Monellin, B & A chains together [54405] (1 species)
  7. 408888Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (11 PDB entries)
  8. 408893Domain d1iv7b_: 1iv7 B: [90708]
    single-chain version
    mutant

Details for d1iv7b_

PDB Entry: 1iv7 (more details), 1.82 Å

PDB Description: crystal structure of single chain monellin

SCOP Domain Sequences for d1iv7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv7b_ d.17.1.1 (B:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

SCOP Domain Coordinates for d1iv7b_:

Click to download the PDB-style file with coordinates for d1iv7b_.
(The format of our PDB-style files is described here.)

Timeline for d1iv7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iv7a_