SCOPe 2.01: Domain d1iuya_: 1iuy A:

Lineage for d1iuya_ (1iuy A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)

6. Protein Cullin-3 homologue [101033] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101034] (1 PDB entry)

8. Domain d1iuya_: 1iuy A: [90705]

Details for d1iuya_

PDB Entry: 1iuy

PDB Description: solution structure of the cullin-3 homologue

PDB Compounds: (A:) cullin-3 homologue

SCOPe Domain Sequences for d1iuya_:

Sequence; same for both SEQRES and ATOM records:

>d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 10090]}
maakqgesdperketrqkvdddrkheieaaivrimksrkkmqhnvlvaevtqqlkarflp
spvvikkriegliereylartpedrkvytyva

Timeline for d1iuya_:

• d1iuya_ first appeared in SCOP 1.67
  
• d1iuya_ appears in SCOP 1.75
  
• d1iuya_ appears in SCOPe 2.02
  
• d1iuya_ appears in the current release, SCOPe 2.08