Lineage for d1iura_ (1iur A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437342Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 437343Family a.2.3.1: Chaperone J-domain [46566] (6 proteins)
  6. 437362Protein Hypothetical protein KIAA0730 [100982] (1 species)
  7. 437363Species Human (Homo sapiens) [TaxId:9606] [100983] (1 PDB entry)
    structural genomics
  8. 437364Domain d1iura_: 1iur A: [90704]

Details for d1iura_

PDB Entry: 1iur (more details)

PDB Description: dnaj domain of human kiaa0730 protein

SCOP Domain Sequences for d1iura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens)}
mhhhhhhlvprgsilkevtsvveqawklpeserkkiirrlylkwhpdknpenhdianevf
khlqneinrlekqafldqnadrasrrtf

SCOP Domain Coordinates for d1iura_:

Click to download the PDB-style file with coordinates for d1iura_.
(The format of our PDB-style files is described here.)

Timeline for d1iura_: