![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.5: PG130-like [102959] (6 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein TT1380 [102960] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry) |
![]() | Domain d1iujb_: 1iuj B: [90702] structural genomics complexed with zn |
PDB Entry: 1iuj (more details), 1.6 Å
SCOPe Domain Sequences for d1iujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iujb_ d.58.4.5 (B:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]} mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee afrawtespafkegharsgtlpkeaflgpnrleafevvldseg
Timeline for d1iujb_: