| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.5: PG130-like [102959] (6 proteins) subfamily of Pfam PF03992 |
| Protein Hypothetical protein TT1380 [102960] (1 species) |
| Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry) |
| Domain d1iujb_: 1iuj B: [90702] structural genomics complexed with zn |
PDB Entry: 1iuj (more details), 1.6 Å
SCOPe Domain Sequences for d1iujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iujb_ d.58.4.5 (B:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]}
mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
afrawtespafkegharsgtlpkeaflgpnrleafevvldseg
Timeline for d1iujb_: